PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04397.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 541aa    MW: 60290.4 Da    PI: 4.394
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04397.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.11.2e-47131392128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              +pGfrFhPtdeelv++yLk+k+ ++kl++ ++i  vd+yk++P++Lp +  +k+++++w++F++r++ky++  r+ r t++g Wka
  Rsa1.0_04397.1_g00001.1  13 APGFRFHPTDEELVMYYLKRKICKRKLRV-NAIGVVDVYKFDPEELPgQsVLKTGDRQWFYFTPRSRKYPNAARSGRCTTTGHWKA 97 
                              69***************************.89**************96347788999***************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tgkd+ v   +++ vglkktLvfy+grap+g++tdWvmhey++
  Rsa1.0_04397.1_g00001.1  98 TGKDRVVSY-NSRSVGLKKTLVFYRGRAPTGQRTDWVMHEYTM 139
                              *****9999.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100551.08712162IPR003441NAC domain
SuperFamilySSF1019412.09E-5313162IPR003441NAC domain
PfamPF023651.8E-2414138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MADSCLKGGK FSAPGFRFHP TDEELVMYYL KRKICKRKLR VNAIGVVDVY KFDPEELPGQ  60
SVLKTGDRQW FYFTPRSRKY PNAARSGRCT TTGHWKATGK DRVVSYNSRS VGLKKTLVFY  120
RGRAPTGQRT DWVMHEYTMD EDELGRCKDA KEYYALYKLF KKSGAGPKNG EEYGAPFQEE  180
EWVDEEEEPV VRCVDNVSLV DVQLDDLEEI LSGIPFAPGV PQTCTNIPQV NREEDLQSTL  240
VNNSAREFLK PQGTEDFFFP NDMPSSYESI DVTSAPNNSV MEPLVFEKDD YIEMDDLLTP  300
DLGASLSLVE KNPAQLLNPG EYYGDFNDFD QLFHDVSMSL DMADLLSNFA DNTSDQEQQL  360
LYQQFQDQTS ENKLNNIMDP TPNLNQFTDD LWLEDDNQTA VLFDQPQSVI CGAFASPSSG  420
VIPASTNLAT SVDDAQDQEG VNGGGGTSPF SSALWAFMDS IPSTPASACE GPINRTFVRM  480
SSFSRIRFSG KANGTPVNTA VIAKKRGINR GFLLLSIVGA LCAIFWVLVP TVQTSGRPVF  540
S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-441413917140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13138RKICKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325131e-114AC232513.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB065E07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013604293.10.0PREDICTED: NAC domain-containing protein 17-like
RefseqXP_013715106.10.0PREDICTED: NAC domain-containing protein 17-like
SwissprotQ9XIC50.0NAC17_ARATH; NAC domain-containing protein 17
TrEMBLA0A078DR370.0A0A078DR37_BRANA; BnaC08g07040D protein
TrEMBLA0A0D3DKM30.0A0A0D3DKM3_BRAOL; Uncharacterized protein
STRINGBra036744.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.10.0NAC domain containing protein 17